Sansa143:
Evening all,hope evryone is doing fine and also the babies!Dis is more of an update to my first post here!Before I proceed,i will like to say thank you to these wonderful e-family,you guys have bin great!
I was able to call my elder sis yesterday,tld her about the the issue on ground!She was really sad and bitter bcause I kept it for dis long witout letting her knw!She den asked if I had tlod mum,which I tld her am yet to!She asked if she could tell mum on my behalf,i gave her the go ahead!
Got a call from mum this morning,she asked me to meet her at her friend's place which I did!What I faced wasn't easy at all,mum involved a social welfare officer!But thank God am over wit dat,i still have one more bridge to cross n Mumci is really bitter and disappointed but I pray she comes around!
That is it,pls pray along wit me dat all will go well and also end in praise!Thanks alot!
Sansa143#Team April#

It is well with u my sister... It shall really end in praise...mummy has to be disappointed but ur decision to tell her is d best...she will eventually come around...after all na she go do omugwo its her ist grandchild so still give her time and pray also...its not easy but God will see u tru...popsy nkor...?

You be correct story teller o! This ya bs na very funny one
Congrats on the birth of ur lo

buccee:
By 10:25pm
Dr: are we ready now?
Five pushes nothing.
2 cuttings
And pop she came out with 2 layers of cord round her neck
Wat a marvellous God.
The sowing...

Favouredmom:


Wow, congrats buccee. God did it!

But you be story teller Sha. I love your birth story

Abi o, na now the story sweet oo, my dear e easy.

jazzyjazz:
You be correct story teller o! This ya bs na very funny one
Congrats on the birth of ur lo

Thanks dear, d story is one I cant forget in hurry.
At point DH ran away.

Hahahahahaha...@mama bucee na wa oo wat a story no be small poopoo and fart..chai....well...congrats oo..

Team march how una dey oo...Una don shop finish...shopped yesterday... Like 80% of my fins are ready...plz is it a must to get baby cot..chai very expensive thing...baby things are cost o..ah ah..
I just had to start shopping on time o..don't want to be walking around by feb/march...bcs of waist pain and swollen feet..
.abeg who has used eurosonic flask...how good is it..does it retain hot water for long?
Abeg Benin mamas where else can I get original coconut oil...I don't fink I would have time to make mine...

He couldn't take it

buccee:


Thanks dear, d story is one I cant forget in hurry.
At point DH ran away.

Favouredmom:


Sorry I've just updated it. I didn't see it because I wasn't copied. Congrats to you dear, VD? 4.1kg? You are a super mom!

Kindly drop your birth story sharply

BS

I had passed my due date and was just have contractions coming n disappearing, went to the hospital at 40weeks n baby presented breech, I had so much ache walking, so I stopped walking, on the 21st evening I couldn't bear the pressure I was feeling in my jajaina, so I checked myself into the hospital again, this time I was 41weeks, I was already tired, immediately my doctor placed me on pitocin at 3am 22nd, waiting for strong contractions, around 10am water broke, and the pain started. It's was bearable for like 2hrs but by 12pm when baby refused to show, I asked for epidural, who send me message!, i was waiting for baby to show, nothing o, doctor said I'm 8cm but baby is still high up, pitocin was stopped, I was placed on oxygen cos baby heart rate was not stable, by 6.30pm the doctor said he didn't have a good feeling abt my labour but I was not afraid, he said we should opt for cs and my husband replied him that he too didn't have a good feeling abt cs, and that I have done vd twice and he know that I can do it. The doctor took my hubby out the delivery room to analyze the situation to him while I was just crying in there, the anesthesia guys came in to prep me for cs, the shaved my jajaina, ready to roll me in for surgery room, and i tot to myself, have u spoken with this little guy yet, immediately I spoke to my baby, I told it how I had his older brothers and I will also have that way, this took less than 30secs o, I felt the pressure to push, I called out and baby head was out, no tear, pushed 5 times and I was done. God saw me thru.

Baby things cost no be small. 
As for the cot or crib, it's a personal choice. If you can comfortably sleep with baby on ya bed, then no need. But if you can't, then, you will need one

nicoleswizzi:
Hahahahahaha...@mama bucee na wa oo wat a story no be small poopoo and fart..chai....well...congrats oo..

Team march how una dey oo...Una don shop finish...shopped yesterday... Like 80% of my fins are ready...plz is it a must to get baby cot..chai very expensive thing...baby things are cost o..ah ah..
I just had to start shopping on time o..don't want to be walking around by feb/march...bcs of waist pain and swollen feet..
.abeg who has used eurosonic flask...how good is it..does it retain hot water for long?
Abeg Benin mamas where else can I get original coconut oil...I don't fink I would have time to make mine...

mimibe:


BS

I had passed my due date and was just have contractions coming n disappearing, went to the hospital at 40weeks n baby presented breech, I had so much ache walking, so I stopped walking, on the 21st evening I couldn't bear the pressure I was feeling in my jajaina, so I checked myself into the hospital again, this time I was 41weeks, I was already tired, immediately my doctor placed me on pitocin at 3am 22nd, waiting for strong contractions, around 10am water broke, and the pain started. It's was bearable for like 2hrs but by 12pm when baby refused to show, I asked for epidural, who send me message!, i was waiting for baby to show, nothing o, doctor said I'm 8cm but baby is still high up, pitocin was stopped, I was placed on oxygen cos baby heart rate was not stable, by 6.30pm the doctor said he didn't have a good feeling abt my labour but I was not afraid, he said we should opt for cs and my husband replied him that he too didn't have a good feeling abt cs, and that I have done vd twice and he know that I can do it. The doctor took my hubby out the delivery room to analyze the situation to him while I was just crying in there, the anesthesia guys came in to prep me for cs, the shaved my jajaina, ready to roll me in for surgery room, and i tot to myself, have u spoken with this little guy yet, immediately I spoke to my baby, I told it how I had his older brothers and I will also have that way, this took less than 30secs o, I felt the pressure to push, I called out and baby head was out, no tear, pushed 5 times and I was done. God saw me thru.

Congratulations dear. I like the "have u spoken to this little guy yet part" It's a confirmation that there is power in the tongue.

Hello fellow mamas pls torch light this matter for me. Everything I lay down for sometime in trying to stand my jajaina will start hurting badly then when I manage to walk from one point to the other it stops after some time. I am currently 33weeks, I went for my Dr's appointment yesterday they did a scan to check my amniotic fluid cos it measured 20cm 2weeks ago and 26cm yesterday. So my Dr said it's high and I need to rush to the hospital once I notice water dropping cos the cord can easily come out and I might go in to early labor or emergency CS. My appointment has been reduced to weekly instead of biweekly. They tested my urine and found +1 protein. I think it because I did the glucose test yesterday so I didn't eat or drink anything for 7:30pm- 10:20am when the test was done. My pregnancy has been a smooth one thus far and I thank God for that. So I'm speaking to my child to cooperate till it's time. Pls mamas who has experienced this and Dr's in our midst put mouth for my matter. God bless u all.

sunbestie:
Buccee mama congrats oo. This ur bs funny but d thing sweet me sha
To all remaining mamas God will perfect wat He started.

Hmmm, e sweet u. Ook
Thanks dear

nicoleswizzi:
Hahahahahaha...@mama bucee na wa oo wat a story no be small poopoo and fart..chai....well...congrats oo..

Team march how una dey oo...Una don shop finish...shopped yesterday... Like 80% of my fins are ready...plz is it a must to get baby cot..chai very expensive thing...baby things are cost o..ah ah..
I just had to start shopping on time o..don't want to be walking around by feb/march...bcs of waist pain and swollen feet..
.abeg who has used eurosonic flask...how good is it..does it retain hot water for long?
Abeg Benin mamas where else can I get original coconut oil...I don't fink I would have time to make mine...

baby cot is not a must ooooo

jazzyjazz:
Baby things cost no be small. 
As for the cot or crib, it's a personal choice. If you can comfortably sleep with baby on ya bed, then no need. But if you can't, then, you will need one

Na wa o...not easy..my dh went with me and he saw evryfin...he was saying my baby won't wear okrika oo..but wen he spend shege yesterday... He appreciated d okrika I bought for baby..lol...I av d baby bed cot (don't knw wat to call it...if I use DAT one and its not comfortable den we will just have to buy d cot...

[quote author=Arihodo post


thanks sis. chai! u b boss o. I don't know how you women do this but u see that cut n stitch part dey fear me no b small because I'm one restless somebody. once I've had my baby I'm up n about doing things myself no matter d amount of help I get. I jus find myself doing all my work wen I'm suppose to rest because no one can do dem d way I like so all those activities makes d episiotomy pain worse.

thanks to all d mamas that touchlight my matter. I really appreciate the love. @mama realdentist, I'll read up on d kegal exercises and massage things and see what I can do on my own to try help my situation.

thanks everyone and enjoy ur day. happy new year in advance.

It will be insensitive and selfish of me if i dont wish u mamas a merry christmas and a great New year ahead..2016 has been a rollercoaster year for all and i pray that as we all march gallantly into 2017,we will sing and shout joyful tidings in whatsoever we put her mind and hands on,its been a pleasure knowing yall and i pray that our angels will be a constant reminder of d goodness and miracles of God in our lives,i cant mention names because everyone holds a special place in my heart,may d Lord uphold us all as we continue to fight d good fight of faith and lastly i pray for all TTC mamas dat God will bless yall with bundles of joy dat wont plant sorrow in ur homes..and always rememba mamas God Gat U..enter into d labour room and believe it,..mo loyal ooo,Tuale!!
#Proudlyteamjuly2016togbaski
#Easypeazydeliverytosure
#Respecttodcappos especiallymitchyyandenkaydewdrop

Lol Congrats! Very funny story

buccee:


Thanks dear, d story is one I cant forget in hurry.
At point DH ran away.

Compliment of the season mamas!

buccee:
By 10:25pm
Dr: are we ready now?
Five pushes nothing.
2 cuttings
And pop she came out with 2 layers of cord round her neck
Wat a marvellous God.
The sowing...

Congrats dearie, God bless your LO!

Akorkor:
I don get alert, God win!!!

God blessed my family with a beautiful baby girl via VD through elective induction. Help me thank the lord.
Cc: favouredmom, enque

Congrats dear, God bless your LO!

Congrats SisiNini, mimibe, freshtestimony, sugarbuns, nifeseun, Akorkor and other mamas. God bless your LOs!

nicoleswizzi:

Na wa o...not easy..my dh went with me and he saw evryfin...he was saying my baby won't wear okrika oo..but wen he spend shege yesterday... He appreciated d okrika I bought for baby..lol...I av d baby bed cot (don't knw wat to call it...if I use DAT one and its not comfortable den we will just have to buy d cot...

if u have a good carpenter u can check google for designs n build one it's cheaper dat way, or if u can get okrika play pen which is around 10k or so it can also serve as cot ...

nicoleswizzi:
Hahahahahaha...@mama bucee na wa oo wat a story no be small poopoo and fart..chai....well...congrats oo..

Team march how una dey oo...Una don shop finish...shopped yesterday... Like 80% of my fins are ready...plz is it a must to get baby cot..chai very expensive thing...baby things are cost o..ah ah..
I just had to start shopping on time o..don't want to be walking around by feb/march...bcs of waist pain and swollen feet..
.abeg who has used eurosonic flask...how good is it..does it retain hot water for long?
Abeg Benin mamas where else can I get original coconut oil...I don't fink I would have time to make mine...

My sister..
For now, my baby cot is as useless as the P in psychology.
DD no send am.

For flask... I saw someone mention Baby boy...not so sure if I have the correct wording.

I think Prilan is nice....for coconut oil.

nkkystel:
Compliment of the season mamas!

Much same to you

nicoleswizzi:
Hahahahahaha...@mama bucee na wa oo wat a story no be small poopoo and fart..chai....well...congrats oo..

Team march how una dey oo...Una don shop finish...shopped yesterday... Like 80% of my fins are ready...plz is it a must to get baby cot..chai very expensive thing...baby things are cost o..ah ah..
I just had to start shopping on time o..don't want to be walking around by feb/march...bcs of waist pain and swollen feet..
.abeg who has used eurosonic flask...how good is it..does it retain hot water for long?
Abeg Benin mamas where else can I get original coconut oil...I don't fink I would have time to make mine...

I dey enjoy d harmattan season oo.
I never start shopping oo but hopefully next month I will start; this recession no good for person body oo

queensnow:
if u have a good carpenter u can check google for designs n build one it's cheaper dat way, or if u can get okrika play pen which is around 10k or so it can also serve as cot ...

Play pen...where will I see DAT one

MizMyColi:


My sister..
For now, my baby cot is as useless as the P in psychology.
DD no send am.

For flask... I saw someone mention Baby boy...not so sure if I have the correct wording.

I think Prilan is nice....for coconut oil.

Prilan? Is it a shop or wat ..or d name of a product...

sunbestie:

I dey enjoy d harmattan season oo.
I never start shopping oo but hopefully next month I will start; this recession no good for person body oo

If u fit buy small small dey keep its better bcs Prices of fins no be here .... Even diaper...

nicoleswizzi:

Prilan? Is it a shop or wat ..or d name of a product...

It's the name.

We are 27weeks 3days and toilet has become our second room, as we have to wee all the time. Terrible headache all the time and I can't seem to get enough sleep. Stomach was tight all through ystday. Na so so complain every day. I have tire.

We are 27weeks 3days and toilet has become our second room, as we have to wee all the time. Terrible headache all the time and I can't seem to get enough sleep. Stomach was tight all through ystday, baby now kicks less than before. guess space has reduced. Na so so complain every day. I have tire.

nicoleswizzi:

It is well with u my sister... It shall really end in praise...mummy has to be disappointed but ur decision to tell her is d best...she will eventually come around...after all na she go do omugwo its her ist grandchild so still give her time and pray also...its not easy but God will see u tru...popsy nkor...?

Popci will be informed by the dad,its him and his people we are waiting!Tnks alot.

nicoleswizzi:

Play pen...where will I see DAT one

u can get it from pple dat sell okrika baby things like walker ..
Where I bought my playpen d women have something like this moses basket very neat for 15k I didn't get it becus I want to get a baby cot.. don't know where u base am in lagos