Welcome, Guest: Register On Nairaland / LOGIN! / Trending / Recent / New
Stats: 3,206,577 members, 7,996,135 topics. Date: Wednesday, 06 November 2024 at 11:49 PM

Pregnancy Are You Pregnant Or Going Through A High Risk Pregnancy,,lets Talk - Health (2660) - Nairaland

Nairaland Forum / Nairaland / General / Health / Pregnancy Are You Pregnant Or Going Through A High Risk Pregnancy,,lets Talk (8513892 Views)

Birth Defects: Are You Pregnant Or Planning To? What You Need To Know! (pics) / Can I Still Get Pregnant Or Do I Remove The Fibroid / Revealed: The Secret Fertility System That Cures Infertility & Get You Pregnant (2) (3) (4)

(1) (2) (3) ... (2657) (2658) (2659) (2660) (2661) (2662) (2663) ... (6979) (Reply) (Go Down)

Re: Pregnancy Are You Pregnant Or Going Through A High Risk Pregnancy,,lets Talk by nicoleswizzi: 8:36am On Dec 28, 2016
Sansa143:
Evening all,hope evryone is doing fine and also the babies!Dis is more of an update to my first post here!Before I proceed,i will like to say thank you to these wonderful e-family,you guys have bin great!
I was able to call my elder sis yesterday,tld her about the the issue on ground!She was really sad and bitter bcause I kept it for dis long witout letting her knw!She den asked if I had tlod mum,which I tld her am yet to!She asked if she could tell mum on my behalf,i gave her the go ahead!
Got a call from mum this morning,she asked me to meet her at her friend's place which I did!What I faced wasn't easy at all,mum involved a social welfare officer!But thank God am over wit dat,i still have one more bridge to cross n Mumci is really bitter and disappointed but I pray she comes around!
That is it,pls pray along wit me dat all will go well and also end in praise!Thanks alot!
Sansa143#Team April#
It is well with u my sister... It shall really end in praise...mummy has to be disappointed but ur decision to tell her is d best...she will eventually come around...after all na she go do omugwo grin its her ist grandchild so still give her time and pray also...its not easy but God will see u tru...popsy nkor...?
Re: Pregnancy Are You Pregnant Or Going Through A High Risk Pregnancy,,lets Talk by jazzyjazz: 8:46am On Dec 28, 2016
You be correct story teller o! This ya bs na very funny one cheesy
Congrats on the birth of ur lo

buccee:
By 10:25pm
Dr: are we ready now?
Five pushes nothing.
2 cuttings
And pop she came out with 2 layers of cord round her neck
Wat a marvellous God.
The sowing...

Re: Pregnancy Are You Pregnant Or Going Through A High Risk Pregnancy,,lets Talk by buccee: 8:47am On Dec 28, 2016
Favouredmom:


Wow, congrats buccee. God did it!

But you be story teller Sha. I love your birth story


Abi o, na now the story sweet oo, my dear e easy.
Re: Pregnancy Are You Pregnant Or Going Through A High Risk Pregnancy,,lets Talk by buccee: 8:50am On Dec 28, 2016
jazzyjazz:
You be correct story teller o! This ya bs na very funny one cheesy
Congrats on the birth of ur lo


Thanks dear, d story is one I cant forget in hurry.
At point DH ran away. shocked

5 Likes

Re: Pregnancy Are You Pregnant Or Going Through A High Risk Pregnancy,,lets Talk by nicoleswizzi: 9:06am On Dec 28, 2016
Hahahahahaha...@mama bucee na wa oo wat a story no be small poopoo and fart..chai....well...congrats oo..

Team march how una dey oo...Una don shop finish...shopped yesterday... Like 80% of my fins are ready...plz is it a must to get baby cot..chai very expensive thing...baby things are cost o..ah ah..
I just had to start shopping on time o..don't want to be walking around by feb/march...bcs of waist pain and swollen feet..
.abeg who has used eurosonic flask...how good is it..does it retain hot water for long?
Abeg Benin mamas where else can I get original coconut oil...I don't fink I would have time to make mine...

1 Like

Re: Pregnancy Are You Pregnant Or Going Through A High Risk Pregnancy,,lets Talk by jazzyjazz: 9:12am On Dec 28, 2016
cheesy cheesy cheesy cheesy
He couldn't take it cheesy
buccee:


Thanks dear, d story is one I cant forget in hurry.
At point DH ran away. shocked
Re: Pregnancy Are You Pregnant Or Going Through A High Risk Pregnancy,,lets Talk by Nobody: 9:13am On Dec 28, 2016
Favouredmom:


Sorry I've just updated it. I didn't see it because I wasn't copied. Congrats to you dear, VD? 4.1kg? You are a super mom!

Kindly drop your birth story sharply smiley

BS

I had passed my due date and was just have contractions coming n disappearing, went to the hospital at 40weeks n baby presented breech, I had so much ache walking, so I stopped walking, on the 21st evening I couldn't bear the pressure I was feeling in my jajaina, so I checked myself into the hospital again, this time I was 41weeks, I was already tired, immediately my doctor placed me on pitocin at 3am 22nd, waiting for strong contractions, around 10am water broke, and the pain started. It's was bearable for like 2hrs but by 12pm when baby refused to show, I asked for epidural, who send me message!, i was waiting for baby to show, nothing o, doctor said I'm 8cm but baby is still high up, pitocin was stopped, I was placed on oxygen cos baby heart rate was not stable, by 6.30pm the doctor said he didn't have a good feeling abt my labour but I was not afraid, he said we should opt for cs and my husband replied him that he too didn't have a good feeling abt cs, and that I have done vd twice and he know that I can do it. The doctor took my hubby out the delivery room to analyze the situation to him while I was just crying in there, the anesthesia guys came in to prep me for cs, the shaved my jajaina, ready to roll me in for surgery room, and i tot to myself, have u spoken with this little guy yet, immediately I spoke to my baby, I told it how I had his older brothers and I will also have that way, this took less than 30secs o, I felt the pressure to push, I called out and baby head was out, no tear, pushed 5 times and I was done. God saw me thru.

42 Likes

Re: Pregnancy Are You Pregnant Or Going Through A High Risk Pregnancy,,lets Talk by jazzyjazz: 9:20am On Dec 28, 2016
Baby things cost no be small. 
As for the cot or crib, it's a personal choice. If you can comfortably sleep with baby on ya bed, then no need. But if you can't, then, you will need one



nicoleswizzi:
Hahahahahaha...@mama bucee na wa oo wat a story no be small poopoo and fart..chai....well...congrats oo..

Team march how una dey oo...Una don shop finish...shopped yesterday... Like 80% of my fins are ready...plz is it a must to get baby cot..chai very expensive thing...baby things are cost o..ah ah..
I just had to start shopping on time o..don't want to be walking around by feb/march...bcs of waist pain and swollen feet..
.abeg who has used eurosonic flask...how good is it..does it retain hot water for long?
Abeg Benin mamas where else can I get original coconut oil...I don't fink I would have time to make mine...
Re: Pregnancy Are You Pregnant Or Going Through A High Risk Pregnancy,,lets Talk by Chanbaby: 9:42am On Dec 28, 2016
mimibe:


BS

I had passed my due date and was just have contractions coming n disappearing, went to the hospital at 40weeks n baby presented breech, I had so much ache walking, so I stopped walking, on the 21st evening I couldn't bear the pressure I was feeling in my jajaina, so I checked myself into the hospital again, this time I was 41weeks, I was already tired, immediately my doctor placed me on pitocin at 3am 22nd, waiting for strong contractions, around 10am water broke, and the pain started. It's was bearable for like 2hrs but by 12pm when baby refused to show, I asked for epidural, who send me message!, i was waiting for baby to show, nothing o, doctor said I'm 8cm but baby is still high up, pitocin was stopped, I was placed on oxygen cos baby heart rate was not stable, by 6.30pm the doctor said he didn't have a good feeling abt my labour but I was not afraid, he said we should opt for cs and my husband replied him that he too didn't have a good feeling abt cs, and that I have done vd twice and he know that I can do it. The doctor took my hubby out the delivery room to analyze the situation to him while I was just crying in there, the anesthesia guys came in to prep me for cs, the shaved my jajaina, ready to roll me in for surgery room, and i tot to myself, have u spoken with this little guy yet, immediately I spoke to my baby, I told it how I had his older brothers and I will also have that way, this took less than 30secs o, I felt the pressure to push, I called out and baby head was out, no tear, pushed 5 times and I was done. God saw me thru.


Congratulations dear. I like the "have u spoken to this little guy yet part" It's a confirmation that there is power in the tongue.

2 Likes

Re: Pregnancy Are You Pregnant Or Going Through A High Risk Pregnancy,,lets Talk by Chanbaby: 9:59am On Dec 28, 2016
Hello fellow mamas pls torch light this matter for me. Everything I lay down for sometime in trying to stand my jajaina will start hurting badly then when I manage to walk from one point to the other it stops after some time. I am currently 33weeks, I went for my Dr's appointment yesterday they did a scan to check my amniotic fluid cos it measured 20cm 2weeks ago and 26cm yesterday. So my Dr said it's high and I need to rush to the hospital once I notice water dropping cos the cord can easily come out and I might go in to early labor or emergency CS. My appointment has been reduced to weekly instead of biweekly. They tested my urine and found +1 protein. I think it because I did the glucose test yesterday so I didn't eat or drink anything for 7:30pm- 10:20am when the test was done. My pregnancy has been a smooth one thus far and I thank God for that. So I'm speaking to my child to cooperate till it's time. Pls mamas who has experienced this and Dr's in our midst put mouth for my matter. God bless u all.

1 Like

Re: Pregnancy Are You Pregnant Or Going Through A High Risk Pregnancy,,lets Talk by buccee: 10:01am On Dec 28, 2016
sunbestie:
Buccee mama congrats oo. This ur bs funny but d thing sweet me sha cheesy
To all remaining mamas God will perfect wat He started.


Hmmm, e sweet u. Ook
Thanks dear
Re: Pregnancy Are You Pregnant Or Going Through A High Risk Pregnancy,,lets Talk by callola: 10:34am On Dec 28, 2016
nicoleswizzi:
Hahahahahaha...@mama bucee na wa oo wat a story no be small poopoo and fart..chai....well...congrats oo..

Team march how una dey oo...Una don shop finish...shopped yesterday... Like 80% of my fins are ready...plz is it a must to get baby cot..chai very expensive thing...baby things are cost o..ah ah..
I just had to start shopping on time o..don't want to be walking around by feb/march...bcs of waist pain and swollen feet..
.abeg who has used eurosonic flask...how good is it..does it retain hot water for long?
Abeg Benin mamas where else can I get original coconut oil...I don't fink I would have time to make mine...
baby cot is not a must ooooo

1 Like

Re: Pregnancy Are You Pregnant Or Going Through A High Risk Pregnancy,,lets Talk by nicoleswizzi: 10:43am On Dec 28, 2016
jazzyjazz:
Baby things cost no be small. 
As for the cot or crib, it's a personal choice. If you can comfortably sleep with baby on ya bed, then no need. But if you can't, then, you will need one



Na wa o...not easy..my dh went with me and he saw evryfin...he was saying my baby won't wear okrika oo..but wen he spend shege yesterday... He appreciated d okrika I bought for baby..lol...I av d baby bed cot (don't knw wat to call it...if I use DAT one and its not comfortable den we will just have to buy d cot...
Re: Pregnancy Are You Pregnant Or Going Through A High Risk Pregnancy,,lets Talk by omoloulah: 11:27am On Dec 28, 2016
[quote author=Arihodo post


thanks sis. chai! u b boss o. I don't know how you women do this but u see that cut n stitch part dey fear me no b small because I'm one restless somebody. once I've had my baby I'm up n about doing things myself no matter d amount of help I get. I jus find myself doing all my work wen I'm suppose to rest because no one can do dem d way I like so all those activities makes d episiotomy pain worse.

thanks to all d mamas that touchlight my matter. I really appreciate the love. @mama realdentist, I'll read up on d kegal exercises and massage things and see what I can do on my own to try help my situation.

thanks everyone and enjoy ur day. happy new year in advance.

1 Like

Re: Pregnancy Are You Pregnant Or Going Through A High Risk Pregnancy,,lets Talk by Nobody: 11:32am On Dec 28, 2016
It will be insensitive and selfish of me if i dont wish u mamas a merry christmas and a great New year ahead..2016 has been a rollercoaster year for all and i pray that as we all march gallantly into 2017,we will sing and shout joyful tidings in whatsoever we put her mind and hands on,its been a pleasure knowing yall and i pray that our angels will be a constant reminder of d goodness and miracles of God in our lives,i cant mention names because everyone holds a special place in my heart,may d Lord uphold us all as we continue to fight d good fight of faith and lastly i pray for all TTC mamas dat God will bless yall with bundles of joy dat wont plant sorrow in ur homes..and always rememba mamas God Gat U..enter into d labour room and believe it,..mo loyal ooo,Tuale!!
#Proudlyteamjuly2016togbaski
#Easypeazydeliverytosure
#Respecttodcappos especiallymitchyyandenkaydewdrop

20 Likes 1 Share

Re: Pregnancy Are You Pregnant Or Going Through A High Risk Pregnancy,,lets Talk by Nobody: 12:05pm On Dec 28, 2016
Lol cheesy Congrats! Very funny story
buccee:


Thanks dear, d story is one I cant forget in hurry.
At point DH ran away. shocked

1 Like 1 Share

Re: Pregnancy Are You Pregnant Or Going Through A High Risk Pregnancy,,lets Talk by nkkystel(f): 12:06pm On Dec 28, 2016
Compliment of the season mamas!

1 Like

Re: Pregnancy Are You Pregnant Or Going Through A High Risk Pregnancy,,lets Talk by nkkystel(f): 12:08pm On Dec 28, 2016
buccee:
By 10:25pm
Dr: are we ready now?
Five pushes nothing.
2 cuttings
And pop she came out with 2 layers of cord round her neck
Wat a marvellous God.
The sowing...

Congrats dearie, God bless your LO!

1 Like

Re: Pregnancy Are You Pregnant Or Going Through A High Risk Pregnancy,,lets Talk by nkkystel(f): 12:10pm On Dec 28, 2016
Akorkor:
I don get alert, God win!!!

God blessed my family with a beautiful baby girl via VD through elective induction. Help me thank the lord.
Cc: favouredmom, enque
Congrats dear, God bless your LO!

1 Like

Re: Pregnancy Are You Pregnant Or Going Through A High Risk Pregnancy,,lets Talk by nkkystel(f): 12:20pm On Dec 28, 2016
Congrats SisiNini, mimibe, freshtestimony, sugarbuns, nifeseun, Akorkor and other mamas. God bless your LOs!

3 Likes

Re: Pregnancy Are You Pregnant Or Going Through A High Risk Pregnancy,,lets Talk by queensnow: 12:44pm On Dec 28, 2016
nicoleswizzi:

Na wa o...not easy..my dh went with me and he saw evryfin...he was saying my baby won't wear okrika oo..but wen he spend shege yesterday... He appreciated d okrika I bought for baby..lol...I av d baby bed cot (don't knw wat to call it...if I use DAT one and its not comfortable den we will just have to buy d cot...
if u have a good carpenter u can check google for designs n build one it's cheaper dat way, or if u can get okrika play pen which is around 10k or so it can also serve as cot ...
Re: Pregnancy Are You Pregnant Or Going Through A High Risk Pregnancy,,lets Talk by MizMyColi(f): 12:55pm On Dec 28, 2016
nicoleswizzi:
Hahahahahaha...@mama bucee na wa oo wat a story no be small poopoo and fart..chai....well...congrats oo..

Team march how una dey oo...Una don shop finish...shopped yesterday... Like 80% of my fins are ready...plz is it a must to get baby cot..chai very expensive thing...baby things are cost o..ah ah..
I just had to start shopping on time o..don't want to be walking around by feb/march...bcs of waist pain and swollen feet..
.abeg who has used eurosonic flask...how good is it..does it retain hot water for long?
Abeg Benin mamas where else can I get original coconut oil...I don't fink I would have time to make mine...

My sister..
For now, my baby cot is as useless as the P in psychology. sad
DD no send am.

For flask... I saw someone mention Baby boy...not so sure if I have the correct wording.

I think Prilan is nice....for coconut oil.
Re: Pregnancy Are You Pregnant Or Going Through A High Risk Pregnancy,,lets Talk by MizMyColi(f): 12:57pm On Dec 28, 2016
nkkystel:
Compliment of the season mamas!

Much same to yousmiley
Re: Pregnancy Are You Pregnant Or Going Through A High Risk Pregnancy,,lets Talk by sunbestie(f): 1:13pm On Dec 28, 2016
nicoleswizzi:
Hahahahahaha...@mama bucee na wa oo wat a story no be small poopoo and fart..chai....well...congrats oo..

Team march how una dey oo...Una don shop finish...shopped yesterday... Like 80% of my fins are ready...plz is it a must to get baby cot..chai very expensive thing...baby things are cost o..ah ah..
I just had to start shopping on time o..don't want to be walking around by feb/march...bcs of waist pain and swollen feet..
.abeg who has used eurosonic flask...how good is it..does it retain hot water for long?
Abeg Benin mamas where else can I get original coconut oil...I don't fink I would have time to make mine...
I dey enjoy d harmattan season oo.
I never start shopping oo but hopefully next month I will start; this recession no good for person body oo

1 Like

Re: Pregnancy Are You Pregnant Or Going Through A High Risk Pregnancy,,lets Talk by nicoleswizzi: 2:19pm On Dec 28, 2016
queensnow:
if u have a good carpenter u can check google for designs n build one it's cheaper dat way, or if u can get okrika play pen which is around 10k or so it can also serve as cot ...
Play pen...where will I see DAT one
Re: Pregnancy Are You Pregnant Or Going Through A High Risk Pregnancy,,lets Talk by nicoleswizzi: 2:20pm On Dec 28, 2016
MizMyColi:


My sister..
For now, my baby cot is as useless as the P in psychology. sad
DD no send am.

For flask... I saw someone mention Baby boy...not so sure if I have the correct wording.

I think Prilan is nice....for coconut oil.
Prilan? Is it a shop or wat ..or d name of a product...
Re: Pregnancy Are You Pregnant Or Going Through A High Risk Pregnancy,,lets Talk by nicoleswizzi: 2:21pm On Dec 28, 2016
sunbestie:

I dey enjoy d harmattan season oo.
I never start shopping oo but hopefully next month I will start; this recession no good for person body oo

If u fit buy small small dey keep its better bcs Prices of fins no be here .... Even diaper...
Re: Pregnancy Are You Pregnant Or Going Through A High Risk Pregnancy,,lets Talk by MizMyColi(f): 2:22pm On Dec 28, 2016
nicoleswizzi:

Prilan? Is it a shop or wat ..or d name of a product...

It's the name.

1 Like

Re: Pregnancy Are You Pregnant Or Going Through A High Risk Pregnancy,,lets Talk by Yesitsme(f): 2:52pm On Dec 28, 2016
We are 27weeks 3days and toilet has become our second room, as we have to wee all the time. Terrible headache all the time and I can't seem to get enough sleep. Stomach was tight all through ystday. Na so so complain every day. I have tire.
Re: Pregnancy Are You Pregnant Or Going Through A High Risk Pregnancy,,lets Talk by Yesitsme(f): 2:53pm On Dec 28, 2016
We are 27weeks 3days and toilet has become our second room, as we have to wee all the time. Terrible headache all the time and I can't seem to get enough sleep. Stomach was tight all through ystday, baby now kicks less than before. guess space has reduced. Na so so complain every day. I have tire.
Re: Pregnancy Are You Pregnant Or Going Through A High Risk Pregnancy,,lets Talk by Nobody: 3:25pm On Dec 28, 2016
nicoleswizzi:

It is well with u my sister... It shall really end in praise...mummy has to be disappointed but ur decision to tell her is d best...she will eventually come around...after all na she go do omugwo grin its her ist grandchild so still give her time and pray also...its not easy but God will see u tru...popsy nkor...?
Popci will be informed by the dad,its him and his people we are waiting!Tnks alot.

1 Like 1 Share

Re: Pregnancy Are You Pregnant Or Going Through A High Risk Pregnancy,,lets Talk by queensnow: 3:28pm On Dec 28, 2016
nicoleswizzi:

Play pen...where will I see DAT one
u can get it from pple dat sell okrika baby things like walker ..
Where I bought my playpen d women have something like this moses basket very neat for 15k I didn't get it becus I want to get a baby cot.. don't know where u base am in lagos

(1) (2) (3) ... (2657) (2658) (2659) (2660) (2661) (2662) (2663) ... (6979) (Reply)

(Go Up)

Sections: politics (1) business autos (1) jobs (1) career education (1) romance computers phones travel sports fashion health
religion celebs tv-movies music-radio literature webmasters programming techmarket

Links: (1) (2) (3) (4) (5) (6) (7) (8) (9) (10)

Nairaland - Copyright © 2005 - 2024 Oluwaseun Osewa. All rights reserved. See How To Advertise. 68
Disclaimer: Every Nairaland member is solely responsible for anything that he/she posts or uploads on Nairaland.